PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00027.1.g04860.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 661aa    MW: 70874.3 Da    PI: 10.2357
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00027.1.g04860.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.97.9e-37119176360
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                   e+ l+cprC s++tkfCy+nny+++qPr+fC+aC+ryWt+GGalrnvPvG+grrkn++
  Zjn_sc00027.1.g04860.1.am.mk 119 EARLPCPRCRSRDTKFCYFNNYNVNQPRHFCRACHRYWTAGGALRNVPVGSGRRKNRA 176
                                   56789***************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.1E-30121175IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.64122176IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-28123175IPR003851Zinc finger, Dof-type
PROSITE patternPS013610124160IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MRSLRHGFAP GLDRKGVTRT GTFWLDRFAR KRNESVMAST ENTHKLIGID RDMLSHIETP  60
CAGAAGIKLF GKVITTQPQQ PAHRSAALPA PPRQVPQASG RGSVGLLEEA ARARAAAAEA  120
RLPCPRCRSR DTKFCYFNNY NVNQPRHFCR ACHRYWTAGG ALRNVPVGSG RRKNRAMLPS  180
SAHVATATAS DDQGSGSSGS TPMFSTAPAG FFALYHDASS HITVPPAAYN AAGVTETTEL  240
WRWHVSSTAE RSGPMGQENA AASFCGSFGR VVATMMLGHM AANGRKGASK FEDSSSDSSM  300
PRPRYSTAPQ AASEVPQRPA PRLKAAAGSE STGGAPRRPV VKKPPVGGGG AGAGSRVVEL  360
EAKLEKAHGQ LTEMREQLTA AEKARKEARA ALVEAKKRLA AKKRDDLGAA ASAVQGGDGH  420
NKALAAVAAA VGYDEKAGMI ASDTDVLDAV VSSEPENNNV EPKAKNTTGR EVVDNVMSTD  480
DEKMWRQEVD ELSAKLMAKD REGRRGGQQR WGRRGGEAAA CCGGGDAVSR ERWGGGEASG  540
GRGLRWGQAW GREALNELSL ALEQVAPLLQ RESRRGMELQ RRRGALGQAE EGRGDLRGGA  600
LRMGVGLQRG GAEEDWSLEE WWRRRGRGER PCRCWSREEE RGSRLAESVE GDRLDPSGQE  660
V
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270061e-81KJ727006.1 Zea mays clone pUT3982 C2C2-DOF transcription factor (DOF44) gene, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1003322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.12e-31Dof family protein